PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000214515
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 463aa    MW: 52270.8 Da    PI: 5.3424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000214515genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM124.11.2e-38191462128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    ++G+rFhPt eel+++yLk k++g +  ++++i+e++i+++ePw+Lp  ++ ++++ewyf+ +   k+++ ++ +rat++g+Wk+tgk+k v++++
  MDP0000214515  19 QVGYRFHPTKEELISHYLKLKLRGMDSLVSDAIREINICNYEPWELPeISLIKSDDEWYFYNRPIYKKNSRNEVERATATGFWKSTGKEKIVKDRD 114
                    78************************99999****************545556789**************************************** PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++ +g k++L+f +gr +++  t+Wvmhe+++
  MDP0000214515 115 NKIIGKKRILTFRQGRGRNAPITNWVMHEFSI 146
                    ******************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-429166IPR003441NAC domain
PROSITE profilePS5100543.48918166IPR003441NAC domain
PfamPF023659.7E-2020146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MASNGIRFTR VEVGGMLLQV GYRFHPTKEE LISHYLKLKL RGMDSLVSDA IREINICNYE  60
PWELPEISLI KSDDEWYFYN RPIYKKNSRN EVERATATGF WKSTGKEKIV KDRDNKIIGK  120
KRILTFRQGR GRNAPITNWV MHEFSIPQIN PNANQRDFVL CYVKKKSGKN TDVATGDEGE  180
SSNYNNAHDF ENQLQPAHNM HVEEEHNQPP QNLDIFQWHM GSMLANAHDN NDYHGTQSAP  240
GANESDGDSE EFVNTVIVDP YEAFSEQITH ANVLNNSTLP QSPRKVYLKD CGVSSGSATE  300
VQHAVELEET DRLQSVSDED SGASRPIKKS ASSVDVDADS LXINSIQLAS DEYYNNEKHA  360
EEHIQQAKVA AERRAAVDFP PKRNFITESN KDAEAVQGNN TEKGLKQTHN ATTAGNWMSC  420
SFISWETSPP LTSPPSVYLF NTVLGAILFL VFAWEVVLYG QWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-221816617165NO APICAL MERISTEM PROTEIN
1ut4_B8e-221816617165NO APICAL MERISTEM PROTEIN
1ut7_A8e-221816617165NO APICAL MERISTEM PROTEIN
1ut7_B8e-221816617165NO APICAL MERISTEM PROTEIN
4dul_A8e-221816617165NAC domain-containing protein 19
4dul_B8e-221816617165NAC domain-containing protein 19
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008356979.10.0PREDICTED: NAC domain-containing protein 69-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01550.18e-36NAC domain containing protein 69